Pay in 4 interest-free payments of $35.00 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
nasal mucosa
GATA2 Polyclonal Antibody
You can calculate the concentration of Human ARG2 in the samples by comparing the OD of the samples to the standard curve
AA Sequence: MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRt VAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQK GIPVRGKKTK KEQKTAHFLP MAIT
SOX10 Polyclonal Antibody - E-AB-93133 Size:120μL nasal mucosaSOX10 Polyclonal Antibody Sizes: 60L, 120L, 200L Catalogue Numbers: E AB 93133 60, E AB 93133 120, E AB 93133 200 Citations, Manuals and MSDS Available upon request. Abbreviation: SOX10 Target Synonym: SOX10; DOM; PCWH; WS2E; WS4; WS4C Conjugation: Unconjugated Host: Rabbit Species Reactivity: Human, Mouse, Rat Application: WB, IHC, IF Isotype: IgG Clonality: Polyclonal UNIProt ID: P56693 Background: This gene encodes a member of the SOX (SRY related
US$ 185.00
US$ 122.50
US$ 999.50
US$ 185.00
US$ 240.00
US$ 160.00
US$ 284.50
US$ 2299.50
US$ 1249.50